DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tun and R06C7.6

DIOPT Version :9

Sequence 1:NP_001246351.1 Gene:tun / 36743 FlyBaseID:FBgn0034046 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_492048.1 Gene:R06C7.6 / 187641 WormBaseID:WBGene00011065 Length:184 Species:Caenorhabditis elegans


Alignment Length:185 Identity:72/185 - (38%)
Similarity:106/185 - (57%) Gaps:13/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YVSCYCEENVWKLCEQVKRTRPEELSKCYAVFVSNEGRTVPLWRQKAGRGDDQVVIWDYHVFFIH 79
            |.||||||||:||.|::     ::.:..:|:.:||:.:.:|||:|||.:..:..|:|||||..|.
 Worm     9 YQSCYCEENVYKLIEKI-----DDKNGIFAIIISNDCKMIPLWKQKAAKSINGHVLWDYHVIAIE 68

  Fly    80 NPLLNRCLVFDLDTTLPFPTYFHKYVTETFR-SDLALR-PEHHRFFRVIPADTYLIEFSSDRRHM 142
            .. .|...|:|||:||.:...|.:|..:|.. :::|.| .:..|.|||||.:.|:...||||.||
 Worm    69 KE-KNGSKVYDLDSTLEWSCDFLEYWEKTMNLAEMAQRDTKFRRKFRVIPGENYISLLSSDRSHM 132

  Fly   143 RRPDGSWIKPPPSYPPILSN--SNMHCLGDFICMSAGKGPGSVYSLSEFVQNFYK 195
            ...:|.::||||.:|.|.|:  ||   |.:.|.||......:|....|..|.|.|
 Worm   133 LSKNGVYLKPPPEWPLINSHKPSN---LMELIRMSEQIENTTVMDEPELFQLFSK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tunNP_001246351.1 Nt_Gln_amidase 15..185 CDD:286805 68/173 (39%)
R06C7.6NP_492048.1 Nt_Gln_amidase 9..174 CDD:286805 68/173 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166894
Domainoid 1 1.000 113 1.000 Domainoid score I3854
eggNOG 1 0.900 - - E1_KOG3261
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9968
Inparanoid 1 1.050 114 1.000 Inparanoid score I3411
Isobase 1 0.950 - 0 Normalized mean entropy S4023
OMA 1 1.010 - - QHG57858
OrthoDB 1 1.010 - - D1337506at2759
OrthoFinder 1 1.000 - - FOG0006515
OrthoInspector 1 1.000 - - oto20477
orthoMCL 1 0.900 - - OOG6_105008
Panther 1 1.100 - - LDO PTHR13035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2687
SonicParanoid 1 1.000 - - X4749
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.