DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tun and ntaq1

DIOPT Version :9

Sequence 1:NP_001246351.1 Gene:tun / 36743 FlyBaseID:FBgn0034046 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002941442.1 Gene:ntaq1 / 100379822 XenbaseID:XB-GENE-5746198 Length:201 Species:Xenopus tropicalis


Alignment Length:188 Identity:88/188 - (46%)
Similarity:118/188 - (62%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFPKISDCSYVSCYCEENVWKLCEQVKRTRPEELSKCYAVFVSNEGRTVPLWRQKAGRGDDQVVI 70
            |.|..|||.|..||||||||||||.::..||.:|.:..|||:|||.:.:|:|:||:.:||.. ||
 Frog    10 LLPGRSDCHYTGCYCEENVWKLCEYIRDQRPCDLDEFSAVFISNENKMIPIWKQKSAKGDGP-VI 73

  Fly    71 WDYHVFFIHNPLLNRCLVFDLDTTLPFPTYFHKYVTETFRSDLALRPEHHRFFRVIPADTYLIEF 135
            |||||..:.....:...|:||||||.||:..:.|:.|..:||..:..:..|..||:.|..:|..|
 Frog    74 WDYHVILLRESARDGNFVYDLDTTLAFPSSCNAYIREALKSDTNIHCDFKRKLRVVGAREFLQTF 138

  Fly   136 SSDRRHMRRPDGSWIKPPPSYPPILSNSNMHCLGDFICMSAGKGPGSVYSLSEFVQNF 193
            :|||.|||....:|.||||.||.|.:..:...|||||.|:...|.|:||||:||.:.|
 Frog   139 ASDRSHMRDSSSNWTKPPPPYPCIQTAESTMNLGDFISMNPEVGWGTVYSLAEFTERF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tunNP_001246351.1 Nt_Gln_amidase 15..185 CDD:286805 77/169 (46%)
ntaq1XP_002941442.1 Nt_Gln_amidase 19..188 CDD:370670 77/169 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3609
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9968
Inparanoid 1 1.050 184 1.000 Inparanoid score I3832
OMA 1 1.010 - - QHG57858
OrthoDB 1 1.010 - - D1337506at2759
OrthoFinder 1 1.000 - - FOG0006515
OrthoInspector 1 1.000 - - oto104914
Panther 1 1.100 - - LDO PTHR13035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.