DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and VBA1

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_013806.1 Gene:VBA1 / 855113 SGDID:S000004694 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:447 Identity:87/447 - (19%)
Similarity:158/447 - (35%) Gaps:145/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SQASWFAS----VNALSAPIGGLLSGFLLDRIGRKKSLIVLNVLIILAWILLATPSESDQNAFFW 145
            |:..|.|:    .|....|:.|.||    |..|||.:|:.......|..:|......      ..
Yeast    71 SKKQWIATSFLLTNTAFQPLYGKLS----DITGRKSALLTAQFFFGLGCLLTCFARN------VT 125

  Fly   146 QLIVSRFMLGVGMGLASAPPGVYAAEISVPKTRGSLILGTSISVAGGITILYGIGYCIRDDFRLI 210
            :..::|.:.|:|.|..:|...:..::|...:.||        ...|...|::|.|..:......:
Yeast   126 EFSIARAICGIGAGGLNAISSIAVSDICTARERG--------VYQGYANIVFGFGQLLGAPLGGV 182

  Fly   211 ALICCGYQL-------VALLC-VLPLPESHCWLLSKKRVTEAKRSLNYFRGFNKSDEITH-PQVL 266
            .:...|::.       |.:|| ||                 |.:::|.        ::.| |.:.
Yeast   183 FIETIGWRALFGIQVPVIMLCSVL-----------------AIKNINI--------KLFHVPPMK 222

  Fly   267 EEFQLLQKSLQQRNTAVKESFWRNLHEPEVYKPLVILMSL-----FAFQQLTGIFVV-------I 319
            |.:.|                 :||...:::..|.::.::     ....||..:::.       |
Yeast   223 ERYTL-----------------KNLSRIDIFGSLSLVATISGVLFLCSSQLNKLYLALFTIGSFI 270

  Fly   320 VFAVQISQEAGIEIDPFMCAVLIGLARLITTCPMGYILEWWGRRRAGIISTLGMSVCMFLLAGHS 384
            ||.:.....|..:|.||         .|:|              |:..:|:....:..|::.|  
Yeast   271 VFILVERYYATEKILPF---------ELLT--------------RSFCLSSAVTVISSFVVFG-- 310

  Fly   385 QIEILKEVPYLPVVAIVGFIVLSTLGLYTLPFFMISELFPQKVRGPASGLTVAVGMFISFVVLKT 449
              ||.:...||.::..:.   ::..||:.        :||        .::||||..::..||: 
Yeast   311 --EIFRSPIYLQLLQNIS---VTKTGLFL--------IFP--------SISVAVGSLVTGWVLR- 353

  Fly   450 YPGIKEYLGMSNCF--IIFG--VMALFALIFVYLAL----PETRRRTLLEIEEQFRS 498
                ...:.:::|.  ||||  :|.|..|...|..|    |:.....:|| ...|||
Yeast   354 ----NTKINLAHCAYQIIFGGMIMQLLGLGLGYFLLSHLNPDYTIYDMLE-SITFRS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 79/422 (19%)
Sugar_tr 60..496 CDD:278511 84/443 (19%)
VBA1NP_013806.1 MFS_Azr1_MDR_like 42..469 CDD:341045 87/447 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.