DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and GEX1

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_009863.2 Gene:GEX1 / 850289 SGDID:S000000575 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:386 Identity:75/386 - (19%)
Similarity:129/386 - (33%) Gaps:124/386 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LIVSRFMLGVGMGLASAPPGVYAAEISVPKTRGSL-----ILGTSISVAGGI------------- 193
            ||.:.|:.|.|:.|.......|....:...:..||     ::...:||...:             
Yeast    62 LISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLR 126

  Fly   194 -----TILYGIGYCIRDDFRLIALIC-------CGYQLVALLCVLPLPE------------SHCW 234
                 ||.|.:|..|:.....:.:..       |||....||..|.|.:            :..|
Yeast   127 LFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQYASYW 191

  Fly   235 ------LLSKKRVTEAKRSLNYFRGFNKSD-EITHPQVLEEFQLLQKSLQQRNTAVKESFWRNLH 292
                  .:|...:|.|....|:  .:|.:. ...:|  |....::...|..:..:.|.:.||:|.
Yeast   192 PYIIIPWISGNIITAANPQKNW--SWNIAMWAFIYP--LSALPIIFLILYMKYKSSKTAEWRSLK 252

  Fly   293 EPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQEAGIEIDPFMCAVLIGLARLITTCPMGYIL 357
            | :..|           ::..|:|..:||.             |....::|:  |:.|..:|.||
Yeast   253 E-QARK-----------ERTGGLFENLVFL-------------FWKLDIVGI--LLITVSLGCIL 290

  Fly   358 -----------EWWGRRRAGIISTLGMSVCMFLLAGHSQIEILKEVPYLPVVAIVGFIVLSTLGL 411
                       :|   ..:.||:||....|:|.:..:.:.:..|. |.||      |.:||..|:
Yeast   291 VPLTLANETSQKW---HNSKIIATLVSGGCLFFIFLYWEAKFAKS-PLLP------FKLLSDRGI 345

  Fly   412 YT---------LPFFMISE-LFPQKVRGPASGLTVAVGM-------------FISFVVLKT 449
            :.         ..||:..: |:|..:.......|.|..:             |.|.:|.||
Yeast   346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAKT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 75/386 (19%)
Sugar_tr 60..496 CDD:278511 75/386 (19%)
GEX1NP_009863.2 MFS_ARN_like 59..571 CDD:340880 75/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.