DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and STP9

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_175449.1 Gene:STP9 / 841453 AraportID:AT1G50310 Length:517 Species:Arabidopsis thaliana


Alignment Length:458 Identity:116/458 - (25%)
Similarity:204/458 - (44%) Gaps:66/458 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LHQLKDTTEPVHLNDSQASWFASVNALSAPIGGLLSGFLLDRIGRKKSLIVLNVLIILAWILLAT 134
            :|:.:..|.....::.....|.|...|:|.....::..:..:.|||.|:.|..|..::..:.   
plant    67 MHEARRETAYCKFDNQLLQLFTSSLYLAALASSFVASAVTRKYGRKISMFVGGVAFLIGSLF--- 128

  Fly   135 PSESDQNAF---FWQLIVSRFMLGVGMGLASAPPGVYAAEISVPKTRGSLILGTSISVAGGITIL 196
                  |||   ...|||.|.:||||:|.|:....||.:|::..|.||:|.:|..:::..||.|.
plant   129 ------NAFATNVAMLIVGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQMAITIGILIA 187

  Fly   197 ----YGIGYCIRDDFRLIALICCGYQLVALLCVLPLPESHCWLLSKKRVTEAKRSLNYFRGFNKS 257
                ||.....::.:|:...:.....::.::....||::...:|.:.:..:|:..|...||.:..
plant   188 NLINYGTSQMAKNGWRVSLGLAAVPAVIMVIGSFVLPDTPNSMLERGKYEQAREMLQKIRGADNV 252

  Fly   258 DEITHPQVLEEFQLLQKSLQQRNTAVK--ESFWRNLHEPEVYKPLVILMSLFA-FQQLTGIFVVI 319
            |        ||||.|..:.:    |.|  ::.|:|:.:...|:|.::..|... |||:|||.|::
plant   253 D--------EEFQDLCDACE----AAKKVDNPWKNIFQQAKYRPALVFCSAIPFFQQITGINVIM 305

  Fly   320 VFAVQISQEAGIEID-PFMCAVLIGLARLITTCPMGYILEWWGRR----RAGI--------ISTL 371
            .:|..:.:..|...| ..:.||:.|...:::|....|.::.:|||    ..||        :.||
plant   306 FYAPVLFKTLGFADDASLISAVITGAVNVVSTLVSIYAVDRYGRRILFLEGGIQMIVSQIVVGTL 370

  Fly   372 -GMSVCMFLLAGHSQIEILKEVPYLPVVA--IVGFIVLSTLGLY----TLPFFMISELFPQKVRG 429
             ||.   |...|...:        .|..|  |:.||.|...|..    .|.:.:.||:.|.::|.
plant   371 IGMK---FGTTGSGTL--------TPATADWILAFICLYVAGFAWSWGPLGWLVPSEICPLEIRP 424

  Fly   430 PASGLTVAVGMFISFVVLKTYPGIKEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEE 494
            ....:.|:|.||.:|::.:.:..:..::.. ..|..||.|.....:|:|..||||:.   :.|||
plant   425 AGQAINVSVNMFFTFLIGQFFLTMLCHMKF-GLFYFFGGMVAVMTVFIYFLLPETKG---VPIEE 485

  Fly   495 QFR 497
            ..|
plant   486 MGR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 107/438 (24%)
Sugar_tr 60..496 CDD:278511 115/455 (25%)
STP9NP_175449.1 MFS_STP 31..477 CDD:340919 109/442 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.