DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and Slc2a6

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:318 Identity:92/318 - (28%)
Similarity:157/318 - (49%) Gaps:35/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 FRLIALICCGYQLVALLCVLPLPESHCWLLSKKRVTEAKRSLNYFRGFNKSDEITHPQVLEEFQL 271
            :|.:|:...|..||.:|.:..:|.|..:||||.|..||.::|.:.|    :|...|    .||:.
  Rat    10 WRWLAVAGEGPVLVMILLLSFMPNSPRFLLSKSRDEEALQALIWLR----ADSEVH----WEFEQ 66

  Fly   272 LQKSLQQRNTAVKESFWRNLHEPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQEAGIEIDPF 336
            :|.:::::::.|.   |....||.||:|::|.:.:...||||||..::|:...|.....:.:...
  Rat    67 IQDNVRRQSSRVS---WAEAWEPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPSQ 128

  Fly   337 MCAVLIGLARLITTCPMGYILEWWGRRRAGIIS---------TLGMSVCMF--LLAGHSQIEIL- 389
            ..|.::|..||::.......::..||:....:|         |||:.|.:.  .|..:|.:||: 
  Rat   129 QDAAIVGAVRLLSVLIAAVTMDLAGRKVLLYVSASIMFVANLTLGLYVQLVPRTLTPNSTVEIVT 193

  Fly   390 ---KEVP------YL---PVVAIVGFIVLSTLGLYTLPFFMISELFPQKVRGPASGLTVAVGMFI 442
               .|.|      ||   |::|.:.||:...:|...:.:.::||:.|.:.||.||||.|.|....
  Rat   194 LGGTEQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLT 258

  Fly   443 SFVVLKTYPGIKEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEEQFRSGR 500
            :||:.|.:.......|:...|..|..:.|.:|:|....:||||.|:|.:||..|.:.|
  Rat   259 AFVLTKYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQIEAFFHTRR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 82/295 (28%)
Sugar_tr 60..496 CDD:278511 90/312 (29%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.