DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and ght6

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_587739.1 Gene:ght6 / 2538845 PomBaseID:SPCC1235.13 Length:535 Species:Schizosaccharomyces pombe


Alignment Length:435 Identity:107/435 - (24%)
Similarity:183/435 - (42%) Gaps:70/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 IGGLLSGFLLDRIGRKKSLIVLNVLIILAWILLATPSESDQNAFFW-QLIVSRFMLGVGMG-LAS 162
            :|.|||..|.||.|::|.::...::.|...|:..|...|      | |::|::...|:|:| |:.
pombe    71 VGCLLSSPLGDRFGKRKCIMGWTLVYITGVIVQLTTIPS------WVQMMVAKIWTGLGIGALSV 129

  Fly   163 APPGVYAAEISVPKTRGSLI--------LGTSIS-------------------VAGGITILYGIG 200
            ..|| |.:|.|.|..||:::        ||..|:                   |..||.:|:|| 
pombe   130 IAPG-YQSESSPPHIRGAIVTTYQLFITLGIFIAACINMGTHKYTTHPEAQWRVPIGINLLWGI- 192

  Fly   201 YCIRDDFRLIALICCGYQLVALLCVLPLPESHCWLLSKKRVTEAKRSLNYFRGFNKSDEITHPQV 265
                       |:..|        :|.||||..:|..|.|..|..:.|....|.    ...||.:
pombe   193 -----------LMFFG--------MLFLPESPRYLAVKGRNEECMKILTRNAGL----PADHPIM 234

  Fly   266 LEEFQLLQKSLQQRNTAVKESFWRNLHEPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQEAG 330
            .:|:..:|..: :...|.....|..:...|:....::.|.:.|||||||......:..|:.:..|
pombe   235 QKEYNAIQADV-EAELAGGPCSWPQIFSNEIRYRTLLGMGVMAFQQLTGNNYFFYYGTQVFRGTG 298

  Fly   331 IEIDPFMCAVLIGLARLITTCPMGYILEWWGRRRAGIISTLGMSVCMFLLAGHSQIEILKEVPYL 395
            :. .||:.|:::.......|....::||::|||...|:..:..|:|.|:.|......:.:.....
pombe   299 LN-SPFLAALILDAVNFGCTFGAIFVLEYFGRRGPLIVGGVWQSICFFIYASVGDRALTRPNGTS 362

  Fly   396 PVVAIVGFIVLSTLGLYTL-------PFFMISELFPQKVRGPASGLTVAVGMFISFVVLKTYPGI 453
            ...|....||.|.|.:::.       .:.::.|.:|.:.|...:.:..|...|.:|::....|.|
pombe   363 NHRAGAVMIVFSCLFIFSFAQTWAPAAYVIVGESYPIRYRSKCAAVATASNWFWNFMISFFTPFI 427

  Fly   454 KEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEEQFRS 498
            ...:|....: :|....|.|.|.::|...||:..||.||.:.:.|
pombe   428 SNSIGFKYGY-VFAACNLCAAIIIFLFAKETKGLTLEEINQLYLS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 99/414 (24%)
Sugar_tr 60..496 CDD:278511 106/431 (25%)
ght6NP_587739.1 MFS 10..453 CDD:119392 99/415 (24%)
Sugar_tr 11..469 CDD:278511 106/431 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.