DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and K09C4.2

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:111 Identity:28/111 - (25%)
Similarity:44/111 - (39%) Gaps:43/111 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 VLSTLGLYTLPFFMISELFPQKVR---GPASGL-TVAVGM-----------------FISFVVLK 448
            |:...|...:....::||||...|   |.|... ::||||                 |:.||:::
 Worm     8 VVPATGANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFVPFVIVQ 72

  Fly   449 TYPGIKEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEE 494
            |               :||       |::|..:||||.|.:.:|.|
 Worm    73 T---------------VFG-------IYLYRYMPETRGRAVYDIIE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 20/94 (21%)
Sugar_tr 60..496 CDD:278511 28/111 (25%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.