DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and K09C4.2

DIOPT Version :10

Sequence 1:NP_611060.2 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:102 Identity:22/102 - (21%)
Similarity:35/102 - (34%) Gaps:42/102 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EESRLVC-----YFT-----------NWSPDR-AGEYAFNVNDIPVELCTHLTYTFAGVDEDTFE 80
            |.|:.:|     |..           :||..| ...:..||.:...|: ..|...||.:|     
 Worm   116 ESSKTICREDETYILEMVKRALETPYHWSIRRLEARWYINVYEKKHEM-NPLLLEFAAID----- 174

  Fly    81 LRPTDGKFDILQQGYEKFANLKKTNPELKLSLAVGGW 117
                   |::||..:::         ||||   :..|
 Worm   175 -------FNMLQANHQE---------ELKL---ISSW 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_611060.2 MFS_GLUT6_8_Class3_like 46..491 CDD:340916 16/73 (22%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:475125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.