DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8249 and F11D5.5

DIOPT Version :9

Sequence 1:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_508570.4 Gene:F11D5.5 / 184346 WormBaseID:WBGene00017382 Length:382 Species:Caenorhabditis elegans


Alignment Length:304 Identity:74/304 - (24%)
Similarity:132/304 - (43%) Gaps:39/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 FRLIALICCGYQLVALLCVLPLPESHCWLLSKKRVTEAKRSLNYFRGFNKSDEITHPQVLEEFQL 271
            |.|..:|.   ..:....::.||||..||:.:.:|.|||.|:.::.|.|    .|..:|:..| :
 Worm    48 FPLFGMIS---STIVFCFMVQLPESPKWLIQQDKVEEAKVSIRFYHGKN----CTIHEVVTSF-I 104

  Fly   272 LQKSLQQRNTAVKESFWRNLHEPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQEAGIEIDPF 336
            .:|:|..:|....:..|.|   ..:.:.|.|:.:|..|.:....:|..|:.:.:.:.||..:.. 
 Worm   105 KEKNLTDKNRISLKQIWDN---ETLREGLKIVFALLLFLEFDTSYVTSVYTIDMHKSAGFTVQQ- 165

  Fly   337 MCAVLIGLARLITTCPM----GYILEWWGRR------------RAGIISTLGMSVCMFLLAGHSQ 385
              |:.|.|...|.:.|.    .::.:..|||            |..||.:|.:::.:|   |.|.
 Worm   166 --ALNINLIITIFSLPTKFFGTFLSDSIGRRPIFVIAALLQYFRTCIIFSLEITIYIF---GSSW 225

  Fly   386 IEILKEVPYLPVVAIVGFIVLSTLGLYTLPFFMISELFPQKVRGPASGLTVAVGMFISFVVLKTY 450
               |..:.|..|..:...:  |..|:.:|...:..||||...|.......:...:.|.|.:|.::
 Worm   226 ---LTRITYNMVEFLAALV--SATGVNSLRLLLTMELFPPSARTVIGQTQMIASILIGFPILSSF 285

  Fly   451 PGIKEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEE 494
            | |...:.....|:.|.:..|...|:::..:||||.|.:.:|.|
 Worm   286 P-IINTMFPPIFFVPFVITQLLLGIYLFRHMPETRGRAVYDIIE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8249NP_001246349.1 MFS 49..479 CDD:119392 67/287 (23%)
Sugar_tr 60..496 CDD:278511 74/304 (24%)
F11D5.5NP_508570.4 Sugar_tr <1..326 CDD:278511 72/300 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.