DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and MIXL1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:203 Identity:50/203 - (24%)
Similarity:67/203 - (33%) Gaps:64/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AAAAAAAHQAGSGPSNGYG------GQAPPPPVTV---APPTPAATPSIARYAK----------- 195
            |||...|..||.||:...|      |.|||||.::   |||..||.||.::..|           
Human    36 AAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQL 100

  Fly   196 ----------PPALMMNSAGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHKHWLWNPS 250
                      |...:......:.:.|.                   |.:.|.:|.|.:.|..|  
Human   101 LELVFRRTRYPDIHLRERLAALTLLPE-------------------SRIQLLFSPLFQVWFQN-- 144

  Fly   251 LLYYTQAHIQAQAAASGGQFLPYAGG--YLPHAMAAAAASSTSALGGFTKSESSID-LSTPGAAG 312
                .:|..:.|   ||..|.|.|..  .|.|   .|..:.|..|......|..:: |..|...|
Human   145 ----RRAKSRRQ---SGKSFQPLARPEIILNH---CAPGTETKCLKPQLPLEVDVNCLPEPNGVG 199

  Fly   313 DALSDCDS 320
            ..:||..|
Human   200 GGISDSSS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 10/85 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.