Sequence 1: | NP_001261016.1 | Gene: | Poxn / 36741 | FlyBaseID: | FBgn0003130 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001269331.1 | Gene: | MIXL1 / 83881 | HGNCID: | 13363 | Length: | 240 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 67/203 - (33%) | Gaps: | 64/203 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 AAAAAAAHQAGSGPSNGYG------GQAPPPPVTV---APPTPAATPSIARYAK----------- 195
Fly 196 ----------PPALMMNSAGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHKHWLWNPS 250
Fly 251 LLYYTQAHIQAQAAASGGQFLPYAGG--YLPHAMAAAAASSTSALGGFTKSESSID-LSTPGAAG 312
Fly 313 DALSDCDS 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Poxn | NP_001261016.1 | HTH | 5..133 | CDD:304362 | |
MIXL1 | NP_001269331.1 | Homeobox | 89..150 | CDD:278475 | 10/85 (12%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |