DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and mxtx2

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001073284.1 Gene:mxtx2 / 58078 ZFINID:ZDB-GENE-000710-6 Length:296 Species:Danio rerio


Alignment Length:217 Identity:49/217 - (22%)
Similarity:75/217 - (34%) Gaps:74/217 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PAPKMPPSMG----HGHSHGLNPNVSGLDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFL 271
            |:|.:||.|.    .....|:..:...:.:|.:: .:|:.:.||                     
Zfish    96 PSPFLPPHMASVGVSAQQRGIQESPFNIQMSQTS-PQHFTFPPS--------------------- 138

  Fly   272 PYAGGYLPHAMAAAAASSTSALGGFTKSESSIDL-STPGAAGDALSDCDSGKSSPAALSLTASGG 335
                   .::........|..:|  |.|.|..|| :||    |:.|...|.:.||.:..:.|...
Zfish   139 -------DYSTPVVKPRQTRLMG--TSSCSPSDLQATP----DSWSYAGSTQISPESWDVAAENF 190

  Fly   336 GNGAGSAPEASP-----------GSTLSHSRKRNPYSIEELLKKPEKRLRLDS--------NRLE 381
            ||   |..:.||           |||    |...|.|:|.|...|...   ||        |...
Zfish   191 GN---SYKDESPFFLYPPPPYPYGST----RVGCPSSMESLSTSPASS---DSAFWDMGLENCSP 245

  Fly   382 CLESSSCES-----SQDSPVAP 398
            .:..:||.|     :::.||||
Zfish   246 SVPYTSCGSPWDRLTEEQPVAP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
mxtx2NP_001073284.1 HOX 22..76 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.