Sequence 1: | NP_001261016.1 | Gene: | Poxn / 36741 | FlyBaseID: | FBgn0003130 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073284.1 | Gene: | mxtx2 / 58078 | ZFINID: | ZDB-GENE-000710-6 | Length: | 296 | Species: | Danio rerio |
Alignment Length: | 217 | Identity: | 49/217 - (22%) |
---|---|---|---|
Similarity: | 75/217 - (34%) | Gaps: | 74/217 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 PAPKMPPSMG----HGHSHGLNPNVSGLDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFL 271
Fly 272 PYAGGYLPHAMAAAAASSTSALGGFTKSESSIDL-STPGAAGDALSDCDSGKSSPAALSLTASGG 335
Fly 336 GNGAGSAPEASP-----------GSTLSHSRKRNPYSIEELLKKPEKRLRLDS--------NRLE 381
Fly 382 CLESSSCES-----SQDSPVAP 398 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Poxn | NP_001261016.1 | HTH | 5..133 | CDD:304362 | |
mxtx2 | NP_001073284.1 | HOX | 22..76 | CDD:197696 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |