DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and PAX6

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:144 Identity:87/144 - (60%)
Similarity:106/144 - (73%) Gaps:8/144 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRP 69
            |.:|||||||||||||||||..|::||:||..|.|||||||.|.||:|||||||.|:||||||||
Human    85 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRP 149

  Fly    70 GSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSGL 134
            .:|||||.: ||||.||.||.:.|.|...:||||||::|..:.||...::||:|||||:|||   
Human   150 RAIGGSKPR-VATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRN--- 210

  Fly   135 WTDEMTSSQQNAAA 148
                :.|.:|...|
Human   211 ----LASEKQQMGA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 84/127 (66%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 81/124 (65%)
Homeobox 295..348 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.