DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Pax7

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006239325.1 Gene:Pax7 / 500574 RGDID:1564360 Length:505 Species:Rattus norvegicus


Alignment Length:465 Identity:139/465 - (29%)
Similarity:184/465 - (39%) Gaps:149/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRP 69
            ||..||||||||:||||||:.:|.:||::|..|:|||.|||||.||||||||||.|:.|||||||
  Rat    34 GQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRP 98

  Fly    70 GSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPS--ISSINRILR-- 130
            |:|||||.:|||||.|.|||...|.||.|||:||||::|.:...||.|:|||  :|||:|:||  
  Rat    99 GAIGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIK 163

  Fly   131 ------------------------------NSGLWTDE-----------MTSSQQNAAAAAAA-- 152
                                          :.|...||           :...|:.:.....|  
  Rat   164 FGKKEDDEEGDKKEEDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQ 228

  Fly   153 ------AAAAAH----------------------------------QAGSGPSNGYG----GQAP 173
                  |....|                                  |||:.....:.    |..|
  Rat   229 LEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFP 293

  Fly   174 PPPVTVAPPTPAATPSIARYAKPPALMMNSAGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLS- 237
            |..:...||.     .:...|.|...:....|....:|.|..|.:|   |..||....:..|.| 
  Rat   294 PTGMPTLPPY-----QLPDSAYPTTTVSQDGGSTVHRPQPLPPSTM---HQGGLAAAAAAADSSS 350

  Fly   238 -YSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTSALGGFTKSES 301
             |.|.|....::.|.:         ...|......|.:.|..|..|:.                 
  Rat   351 AYGARHSFSSYSDSFM---------NPGAPSNHMNPVSNGLSPQVMSI----------------- 389

  Fly   302 SIDLSTPGA------AGDALSDCDSGKSSPAALSLTASGGGNGAGSAPEASPGSTLSHSRKRNP- 359
               ||.|.|      |..::|....|..|.:::|.:.|      ..|....||.:|..|:...| 
  Rat   390 ---LSNPSAVPPQPQADFSISPLHGGLDSASSISASCS------QRADSIKPGDSLPTSQSYCPP 445

  Fly   360 ------YSIE 363
                  ||::
  Rat   446 TYSTTGYSVD 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 85/161 (53%)
Pax7XP_006239325.1 PAX 34..161 CDD:128645 83/126 (66%)
Homeobox 220..274 CDD:395001 3/53 (6%)
Pax7 <354..385 CDD:403540 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.