DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Pax5

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_038966491.1 Gene:Pax5 / 500453 RGDID:1565236 Length:410 Species:Rattus norvegicus


Alignment Length:422 Identity:154/422 - (36%)
Similarity:187/422 - (44%) Gaps:134/422 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIR 68
            ||..|||||||||||||||||.||:|||:||..|||||||||||.||||||||||.|:||||||:
  Rat    15 TGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIK 79

  Fly    69 PGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSG 133
            ||.|||||.| ||||.||:||...|.:|..|||||||::|..:||||..:|||:||||||:|   
  Rat    80 PGVIGGSKPK-VATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR--- 140

  Fly   134 LWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPPA 198
                  |..|                           |.|..||..:..:..:|.|:.:.:   :
  Rat   141 ------TKVQ---------------------------QPPNQPVPASSHSIVSTGSVTQVS---S 169

  Fly   199 LMMNSAGE-----------MPIKPAPKMPPSMG-------HGHS----HGLNPNVSG-------- 233
            :..:|||.           .|.....|.....|       :|||    ..|...:.|        
  Rat   170 VSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL 234

  Fly   234 --LDLSYSALH-----------KHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAA 285
              ||..:...|           |...|.|.|:  .|...|.||...  |...|:      |||:.
  Rat   235 EVLDRVFERQHYSDIFTTTEPIKPEQWCPVLM--RQYLAQPQAVLF--QTTEYS------AMASL 289

  Fly   286 AASSTSALGGFTKSESSIDLSTPGAAGDALSDCDSGKSSPA-----------ALSLTASG----- 334
            |.|         ..:...:|::|..|       |.|.|.|.           ..|.|..|     
  Rat   290 AGS---------LDDMKANLTSPTPA-------DIGSSVPGPQSYPIVTGRDLASTTLPGYPPHV 338

  Fly   335 --GGNGAGSAPEAS---PGSTLSHSRKRNPYS 361
              .|.|:.|||..:   |||..|.|    |||
  Rat   339 PPAGQGSYSAPTLTGMVPGSEFSGS----PYS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 93/127 (73%)
Pax5XP_038966491.1 PAX 16..140 CDD:128645 92/124 (74%)
Pax2_C 298..408 CDD:403565 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002430
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.