DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Poxm

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:398 Identity:141/398 - (35%)
Similarity:180/398 - (45%) Gaps:116/398 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGS 66
            |..|:  |||||||||||||||:..|.|||:||..|:|||||||||.||||||||||.|::||||
  Fly     8 PQYGE--VNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGS 70

  Fly    67 IRPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRN 131
            |.||:|||||.: |.||.||..|..||:.:.|:||||||::|..:.:||.::|||:|||:|||||
  Fly    71 ILPGAIGGSKPR-VTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRN 134

  Fly   132 --------------------SGLWTDEMTSSQQNAAAA--------------------------A 150
                                ||..:......|.|..:|                          :
  Fly   135 KLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQS 199

  Fly   151 AAAAAAAHQA---GSGPSNGYGGQAPPPPVTVA--PPTPAATPSIARYAKPPALMMNSAGEMPIK 210
            |||||:||..   ....::.|.....|.....|  ..||..:||      ||    ..||     
  Fly   200 AAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPS------PP----QGAG----- 249

  Fly   211 PAPKMPPSMGHG---HSHGLNPNVSGLDLSYSALHKHWLWNPSLLYYTQ--AHIQAQAAASGGQF 270
                     |.|   |.|.|.      .::.:|...||   ||....:.  ||.||.|..:..|.
  Fly   250 ---------GQGSVPHPHQLR------SVAAAAAAAHW---PSSHSVSDILAHHQAVALRASCQV 296

  Fly   271 LPYAGGYLPHAMAAAAASSTSALGGFTKSESSIDLSTPG-----AAGDALSDCD--SGKSSPAAL 328
            ....||                :||...:.|.:.: ||.     |.|..|.||:  :|:.||...
  Fly   297 GVGVGG----------------MGGMGSTVSPLPM-TPSPVAGTAGGQPLLDCEGGAGQQSPYNY 344

  Fly   329 SLTASGGG 336
            .:....||
  Fly   345 YMYFQNGG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 84/147 (57%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 81/125 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.