DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and eve

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:364 Identity:82/364 - (22%)
Similarity:130/364 - (35%) Gaps:111/364 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SIGGSKTKQV-ATPTVVKKIIRLKEENSGMFAWEIREQ--LQQQRVCD-------PSSVPSISSI 125
            |:.||:..:: |.|:|.:.......:..|....|..::  :.:.|.|:       |.|...:...
  Fly    55 SLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQ 119

  Fly   126 NRILRN-----SGLWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPA 185
            ||.:::     :..|  ...:...:.|.||:...|||:..|          .|.||  .||...|
  Fly   120 NRRMKDKRQRIAVAW--PYAAVYSDPAFAASILQAAANSVG----------MPYPP--YAPAAAA 170

  Fly   186 ATPSIARYAKPPALMMNSAGEMPIKPAPKMPPSMGHGHS-HGLNPNVSGLDLSYSALHKHWLWNP 249
            |..:.|..|..|.:    |..||....|:||.....||| |..:|:..|   .|.          
  Fly   171 AAAAAAAVATNPMM----ATGMPPMGMPQMPTMQMPGHSGHAGHPSPYG---QYR---------- 218

  Fly   250 SLLYYTQAHIQAQAAASGGQFLPYAGG---YLPHAMAAAAASSTSALG----------------- 294
                ||..||.|:.|.      |:..|   :.||.|.::|..|:.:.|                 
  Fly   219 ----YTPYHIPARPAP------PHPAGPHMHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGL 273

  Fly   295 --GFTKSE--------------SSIDLSTPGAAGDALSD----CDSGKSSPAALSLTASGGGNGA 339
              |..|::              |::.||..|:....:.|    ..|..|.||...||.       
  Fly   274 GVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVPAPAPLTT------- 331

  Fly   340 GSAPEASPGSTLSHSRKR-----NPYSIEELLKKPEKRL 373
             ::|..:|| .|..|.||     :|.....::.:|:.:|
  Fly   332 -TSPLPAPG-LLMPSAKRPASDMSPPPTTTVIAEPKPKL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 14/76 (18%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 8/51 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.