DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Gsc

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:82/226 - (36%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LKEENSGMFAWEIREQLQQQRV-------CDPSSVPSISSINRIL---RNSG-----LWT-DEMT 140
            |..:..|.....::..||||..       ..|||.....|...||   |..|     |:| |.:.
  Fly   106 LNSQQCGYLGQRLQSVLQQQHAQHQQSQSQTPSSDDGSQSGVTILEEERRGGAAAASLFTIDSIL 170

  Fly   141 SSQQNAAAAAAAAAAAAHQAGSGPSNGY------------GGQAPPPPVTVAPPTPAATPSIARY 193
            .|:|.  ....|.:..:|.:.:|..||.            |.::|..|.:.:..:.||:|  .|.
  Fly   171 GSRQQ--GGGTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSNSSSSAAASP--IRP 231

  Fly   194 AKPPALMMNSAGEMPIKPAPKMPPSMGHGH-----SHGLNPNVSGLDLSYSALHKHWLWNPSLLY 253
            .:.||::.:              |.:..||     :.|...:.|...::|...:.:::...::.:
  Fly   232 QRVPAMLQH--------------PGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAVAH 282

  Fly   254 YT----QAHIQAQAAASGGQFLPYAGGYLPH 280
            ..    |||:...||...|.      |:.||
  Fly   283 VAAAQMQAHVSGAAAGLSGH------GHHPH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 13/50 (26%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.