DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and CG11294

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:193 Identity:49/193 - (25%)
Similarity:63/193 - (32%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 AHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPS-IARYAKPPALMMNSAGEMPIKPAPKMPPSMG 220
            |.|.||    |.|..|.||..|....:.|:..| :|.....|    ||.....:.||.:......
  Fly   109 AVQGGS----GNGATARPPSQTPENLSSASKDSELAEVGNGP----NSGSFTMMHPAFQQQHQQQ 165

  Fly   221 HGHSHGLNPNVSGLDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAA 285
            ....|....:...|..:|:.|.         ||...:|         |..|   ||     |||.
  Fly   166 QHQGHQQATDQDKLSKTYTELK---------LYKAPSH---------GMEL---GG-----MAAL 204

  Fly   286 AASSTSALGGFTKSESSIDLSTPGAAGDALSDCDSGKSSPAALSLTASGGGNGAGSAPEASPG 348
            :..|.....|....|  |||:    :|..:....|.|...........|....|||| ||:.|
  Fly   205 SGHSDEGSDGSDSEE--IDLT----SGACIDFSQSSKLQQQQQQQQQQGTQGAAGSA-EANGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.