DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and oc

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:393 Identity:81/393 - (20%)
Similarity:117/393 - (29%) Gaps:154/393 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IRLKEENSGMFAW------EIREQLQQQR------------------VCDPSSVPSISSINRILR 130
            :::....|.:..|      :.|:|||||:                  .|..||..|.|:.|    
  Fly   102 LKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSN---- 162

  Fly   131 NSGLWTDEMT-------------------SSQQ------------NAAAAAAAAAAAAHQAGSGP 164
            |:|..::..|                   ||||            |:|||||:||||.       
  Fly   163 NNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAV------- 220

  Fly   165 SNGYGGQAPPPPVTVAPPTPAATPSIARYAKPPALMMNSAGEMPIKPAPKMPPSMGHGHSHGLNP 229
                                ||..||..:            ......|.....|.|...|...|.
  Fly   221 --------------------AAAQSIKTH------------HSSFLSAAAAAASGGTNQSANNNS 253

  Fly   230 NVSGLDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTSALG 294
            |.:                      .|.:....:::|||.....|||:|..|.||||.:.|:|  
  Fly   254 NNN----------------------NQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAA-- 294

  Fly   295 GFTKSESSIDLSTPGAAGDALSDCDSGKSSPAALSLTASGGGNGAGSAP-----------EASPG 348
               ...||..|.||..:...:|.....:........:..|||.|.|::.           ....|
  Fly   295 ---HQNSSPLLPTPATSVSPVSIVCKKEHLSGGYGSSVGGGGGGGGASSGGLNLGVGVGVGVGVG 356

  Fly   349 STLSHSRKRNPY------------------SIEELLKKPEKRLRLDSNRLECLESSSCESSQDSP 395
            ..:|....|:||                  ||.........||......:..::|||..::...|
  Fly   357 VGVSQDLLRSPYDQLKDAGGDIGAGVHHHHSIYGSAAGSNPRLLQPGGNITPMDSSSSITTPSPP 421

  Fly   396 VAP 398
            :.|
  Fly   422 ITP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 15/66 (23%)
ocNP_001356934.1 Homeobox 71..123 CDD:333795 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.