DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Vsx1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:92/260 - (35%) Gaps:78/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 REQLQQQRVCDPSSVPSISSINRILRNSGLWTDEMTSSQQNAAAAAAAAAAAAH--QAGSGPSN- 166
            ::|.|||:........:|.|    ||.|...:.:::   :.:||||||||||||  .....|:| 
  Fly    65 QQQQQQQQQLQQQQQQAIDS----LRESRSISPDVS---RLSAAAAAAAAAAAHCQLPVFNPANF 122

  Fly   167 ----GYGGQAPPPPVTVAPPTPAATPSIARYAKPPALMMNSAGEMPIKPAPKMPPSM-GHGHSHG 226
                ||...|.|.....|......|.:.|.|.:         |.:|  |....|... ||...| 
  Fly   123 YAAAGYAAAADPGNAAAAHHHHMTTLAAAAYLR---------GFLP--PGFSTPHEFRGHFQQH- 175

  Fly   227 LNPNVSGLDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTS 291
                                        ..|....||||.|.::                |||.:
  Fly   176 ----------------------------FGAQFAEQAAARGQEY----------------ASSLA 196

  Fly   292 ALGGFTKSESSIDLSTPGAAGDALSDCDSGKSSPAALSL------TASGGGNGAGSAPEASPGST 350
            ...|..:|.|. :.|:.|..|...|...||..:|.:..|      |||.||:|.|:....|.|.:
  Fly   197 NASGDEQSPSK-NSSSSGNGGSGGSGSGSGGGNPTSNGLGHLGSPTASNGGSGGGAGVGGSGGGS 260

  Fly   351  350
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 8/27 (30%)
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.