DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Dux4

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006252740.1 Gene:Dux4 / 306226 RGDID:1311053 Length:357 Species:Rattus norvegicus


Alignment Length:363 Identity:72/363 - (19%)
Similarity:118/363 - (32%) Gaps:136/363 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNQLGGVFVNGRPLPDCVRRRIV-------------------DLALCGVRPCDISRQLLVSHGCV 54
            :|..||:...     :..||||:                   |||..|    .::::|.:|.   
  Rat     3 LNCTGGLLEK-----EARRRRIILNQSQKDTLRVWFEKNPNPDLATRG----HLAKKLGISE--- 55

  Fly    55 SKILTRF-------------------YETGSIRPGSIGGSKTKQVATPTVVKKIIRLKEEN--SG 98
            |:|:|.|                   .|.|..:|......:::...|...:..:|...|:|  .|
  Rat    56 SQIMTWFQKHRKIRKQVEFECCSEESQEQGQDKPRVKEAGRSRTHFTKFQIDILIEAFEKNRFPG 120

  Fly    99 MFAWEIREQLQQQ-----------------RVCDP------SSVPSISSINRILRNSGLWTDEMT 140
            :..   ||:|.|:                 |..||      :|.|..||.....:.:|    ::.
  Rat   121 IVT---REKLAQETGIPESRIHIWFQNRRARHPDPKQGTRATSHPPESSQCPAQKTTG----QLA 178

  Fly   141 SSQQNAAAAAAAAAAAAHQAGSGPSN-GYGGQAPPPPVTVAPPTPAATPSIARYA--KPPALMMN 202
            .|:...::.:.....:.....:||.: ..|.|...|..||..|:..    :.|..  :.|:|.::
  Rat   179 PSKDPTSSCSVILPLSPPHTPNGPLDLSRGRQKQLPETTVLQPSQV----VQRRGDDQNPSLFID 239

  Fly   203 SAGEMPIKP---------APKMPPSMGHGHSHGLNPNVSGLDL-------SYSALHKH------- 244
            ...|:. .|         ||...|....||:...|   |||.:       ..||:::|       
  Rat   240 HLSEVK-SPGEKEGFHTQAPLQLPIQKRGHNPSEN---SGLSVPPLEDSTQVSAVNQHFRKPDQK 300

  Fly   245 ----------WL------WNPSLLYY---TQAH-IQAQ 262
                      |.      |.|...|:   |..| .|||
  Rat   301 DLAFLQHWDEWFQSMLAEWMPDKGYWAVKTDLHPWQAQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 36/186 (19%)
Dux4XP_006252740.1 homeodomain 15..71 CDD:238039 14/62 (23%)
Homeobox 97..149 CDD:278475 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.