DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Pax2

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006231505.2 Gene:Pax2 / 293992 RGDID:1305568 Length:432 Species:Rattus norvegicus


Alignment Length:420 Identity:152/420 - (36%)
Similarity:188/420 - (44%) Gaps:121/420 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSI 67
            |.|..|||||||||||||||||.||:|||:||..|||||||||||.||||||||||.|:||||||
  Rat    14 HPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSI 78

  Fly    68 RPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNS 132
            :||.|||||.| ||||.||.||...|.:|..|||||||::|..:.:||..:|||:||||||:|  
  Rat    79 KPGVIGGSKPK-VATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR-- 140

  Fly   133 GLWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPP 197
                   |..||           ..|....|...|    ...|..|:.|.|  |:|.::..:..|
  Rat   141 -------TKVQQ-----------PFHPTPDGAGTG----VTAPGHTIVPST--ASPPVSSASNDP 181

  Fly   198 ALMMNSAGEMPIKPAPKMPPSMGH-------------GH----------------SHGLNPN--- 230
                  .|...|.....:|.|.|.             .|                |.|..||   
  Rat   182 ------VGSYSINGILGIPRSNGEKRKREEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDS 240

  Fly   231 VSGLDLSYSALHKHW----------------LWNPSL--LYYTQAHIQAQAAASGGQF-LPYAGG 276
            .||:|    :|.||.                ...||.  ::....||:::   .|.:: ||....
  Rat   241 QSGVD----SLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSE---QGNEYSLPALTP 298

  Fly   277 YLPHAMAAAAASSTSALGGFTKSESSIDLSTPGAAGDALSDCDSGKSSPAALSLTASG-----GG 336
            .|....::.:||:...||    |..|...:.|...|..::            |.|..|     ..
  Rat   299 GLDEVKSSLSASTNPELG----SNVSGTQTYPVVTGRDMA------------STTLPGYPPHVPP 347

  Fly   337 NGAGSAPEAS-----PGSTLSHSRKRNPYS 361
            .|.||.|.::     |||..|    .||||
  Rat   348 TGQGSYPTSTLAGMVPGSEFS----GNPYS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 91/127 (72%)
Pax2XP_006231505.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002430
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.