DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and sebox

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:198 Identity:42/198 - (21%)
Similarity:65/198 - (32%) Gaps:57/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KHWLWNPSLLYYTQAHIQAQAAASGGQF--------------LPYAGGYLPHAMAAAAASSTSAL 293
            ||.|.:|.|  ....|::.|.......|              .||....|...:||......|.:
Zfish    40 KHMLSSPEL--DRTGHVEGQRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKI 102

  Fly   294 GGF-----TKSESSIDLSTPGAAGDALSDCDSGKSSPAALSLTASGGGNGAGSAPEASPGSTLSH 353
            ..:     .:|..|..|.||.:......||....:.| .|:|..|         |||:  .:|.|
Zfish   103 QVWFQNRRARSMKSKKLITPVSRRSPAKDCTFPATHP-DLNLEQS---------PEAN--KSLRH 155

  Fly   354 SRKR------NPYSIEELLKKPEKRLRLDSNRLECLESSSCESSQDSPVAPPLETPEDEDPAEAE 412
            .::.      ||:        |:.|..:..:..|.|:.::..|          |||.|...:...
Zfish   156 HQQSLIRQALNPW--------PQNRPPISPDLPEILQWANRNS----------ETPGDSSFSSCP 202

  Fly   413 EEQ 415
            .|:
Zfish   203 SER 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
seboxNP_001306981.1 COG5576 13..159 CDD:227863 30/132 (23%)
Homeobox 61..112 CDD:278475 7/50 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.