DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Duxbl1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_899245.1 Gene:Duxbl1 / 278672 MGIID:1916048 Length:350 Species:Mus musculus


Alignment Length:341 Identity:67/341 - (19%)
Similarity:113/341 - (33%) Gaps:116/341 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRRIV-------------------DLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGS- 71
            ||||:                   |||..|    .::::|.:|.   |:|:|.|.:...||..: 
Mouse    16 RRRIILTQSQKDTLRVWFEKNPNPDLATRG----HLAKELGISE---SQIMTWFQKHRKIRKQAE 73

  Fly    72 ----IGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIR-EQLQQQRVCDPSSVPSISSINRILRN 131
                ...|:.::...|.|  |..|....:...|..:|. |..::.|      .|.|.:..::.:.
Mouse    74 FACCSEESQEQEQDKPRV--KEARRSRTHFTKFQTDILIEAFEKNR------FPGIVTREKLAQQ 130

  Fly   132 SGLWTDEMTSSQQNAAA----AAAAAAAAAH--QAGSGPSNGYGGQ-APPPPVT-----VAPPTP 184
            :|:....:....||..|    .........|  |:..||:....|: ||...:|     :.|.:|
Mouse   131 TGIPESRIHIWFQNRRARHPDPGQNTQKTPHPPQSSQGPTQKTVGKLAPSKTLTSSASVILPLSP 195

  Fly   185 AATP------SIARYAKPPALMMNSAGEMPIKPAPKMPPSMGH-----------GHS-------- 224
            ..||      |..|..:.|...:..:.::..:.:....|:.||           .||        
Mouse   196 PHTPNGPLDLSKGRQKQLPGTTLLQSSQVVQQRSDDQNPNKGHLSPTTTPGEQGFHSQPPLQLLT 260

  Fly   225 --HGLNPNVSG----------------------LDLSYSALHKHW---------LWNPSLLYYTQ 256
              .|.||..||                      ||.:.|:..:||         .|.|...|:::
Mouse   261 QNRGHNPRESGGLAVPRLEDCTQVPAVNQHFRKLDQNDSSFLQHWDEWFGSMLAEWMPDKEYWSE 325

  Fly   257 A------HIQAQAAAS 266
            .      .:|.:..||
Mouse   326 KAELHPWQVQLRQLAS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 27/130 (21%)
Duxbl1NP_899245.1 homeodomain 15..71 CDD:238039 16/61 (26%)
HOX 95..149 CDD:197696 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.