DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Gm4981

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:234 Identity:51/234 - (21%)
Similarity:65/234 - (27%) Gaps:75/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 WLWNPSLLYYTQAHIQAQ------AAASGGQFL-PYAGGY-------LPHAMAAAA---ASSTSA 292
            ||.|.....:.:....||      :..|||... |...|:       ||...|.:.   .:|||.
Mouse    52 WLKNKRARRHRRGRPTAQDQDLLASQVSGGAPAGPVGRGHEVAQESSLPQEEAGSTGMDTTSTSY 116

  Fly   293 LGGFTKSESSIDLSTPGAAGDALSDCDSGKSSPAALSL---------------TASGGGNGAGSA 342
            ...|.:......:|.|..||.......:|...|..|.|               ....|.:.....
Mouse   117 SPSFCRESQLSQVSQPRGAGQKEVPTQAGNVGPLELLLDELQDEVQVKEHVPDPLDLGSDPGARE 181

  Fly   343 PEASPGSTLSHSRKRNPYSIEELLKKPEKRLRLDS-------NRLECLESSSCESSQDSPVAPP- 399
            ||.|..|..|                      ||.       ..:..:.|:.|..||.|.||.| 
Mouse   182 PEGSQDSLQS----------------------LDEAANSGWHTSVPSISSTLCRESQPSQVAQPS 224

  Fly   400 ----LETPEDE---DPAE------AEEEQEEEDSVEVVN 425
                .:.|...   ||.|      ..|.|.||.....||
Mouse   225 GPGQAQAPTQSGFIDPLELFLDELLTEVQLEEQGPAPVN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.