DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and npax-3

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_502006.2 Gene:npax-3 / 187848 WormBaseID:WBGene00011257 Length:205 Species:Caenorhabditis elegans


Alignment Length:92 Identity:34/92 - (36%)
Similarity:45/92 - (48%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRP--- 69
            |.|..|..:..||||....|.||:.|...|::...||:.|.:||||||||::||..||.:.|   
 Worm    81 GTNLYGRPYCPGRPLSMEERTRIIQLHNNGMKVNAISKSLCISHGCVSKIISRFRATGVLLPACS 145

  Fly    70 ----------GSIGGSKTKQVATPTVV 86
                      .|:.||..:|...|..|
 Worm   146 PEQRKSRKRKSSMEGSAMEQSFIPVFV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 34/92 (37%)
npax-3NP_502006.2 PAX 78..200 CDD:128645 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.