DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and pax-1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505120.1 Gene:pax-1 / 187105 WormBaseID:WBGene00003937 Length:257 Species:Caenorhabditis elegans


Alignment Length:138 Identity:82/138 - (59%)
Similarity:103/138 - (74%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGS 71
            |.|||||||||||||||..:|.:||:|:..|.|||||||||.:||||||||||||.|.|:|.||:
 Worm    63 AEVNQLGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHGCVSKILTRFSENGTIMPGT 127

  Fly    72 IGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSGLWT 136
            ||||:.: |.||.||:.|..||..:.|:||||||::|....:||.:::||:|||:|||||.....
 Worm   128 IGGSRPR-VTTPKVVEYIRSLKRSDPGIFAWEIRDRLISADICDRANLPSVSSISRILRNKNGGN 191

  Fly   137 DEMTSSQQ 144
            ...:||.|
 Worm   192 SSSSSSSQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 79/125 (63%)
pax-1NP_505120.1 PAX 61..185 CDD:128645 76/122 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.