DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and pax-2

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_500513.1 Gene:pax-2 / 187062 WormBaseID:WBGene00003938 Length:351 Species:Caenorhabditis elegans


Alignment Length:259 Identity:111/259 - (42%)
Similarity:150/259 - (57%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSI 67
            ||   |||||||||||||||||.:|.:||:::..|.|||||||||.||||||||||.|:|.|||:
 Worm    92 HT---GVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSV 153

  Fly    68 RPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNS 132
            |||.|||||.| ||||.||:.|...|..|..|||||||::|.:.::|...:|||:||||||:||.
 Worm   154 RPGVIGGSKPK-VATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNK 217

  Fly   133 GLWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPP 197
            .......|.:....:.|..::|.:.:|           ::||..|........:...:.::....
 Worm   218 SFMAQLATPTSVTPSVARPSSATSQNQ-----------RSPPRGVQQHMQQSTSVQQLQQFQLTS 271

  Fly   198 ALMMNSAGEMPIKPAPKMPPSMGHGHSHGLN------PNVSGLDLSYSALHKHWLWNPSLLYYT 255
            |..:||   :..:||..:|     |.:|.:|      |:.|.||..::.|..|.. :.||:|.|
 Worm   272 AATVNS---LISRPAFAIP-----GTTHSINGLLGTFPHSSLLDDKFTNLSTHSA-DMSLVYPT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 83/127 (65%)
pax-2NP_500513.1 PAX 91..215 CDD:128645 83/126 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002430
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.