DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Pax5

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_032808.1 Gene:Pax5 / 18507 MGIID:97489 Length:391 Species:Mus musculus


Alignment Length:411 Identity:149/411 - (36%)
Similarity:185/411 - (45%) Gaps:131/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIR 68
            ||..|||||||||||||||||.||:|||:||..|||||||||||.||||||||||.|:||||||:
Mouse    15 TGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIK 79

  Fly    69 PGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSG 133
            ||.|||||.| ||||.||:||...|.:|..|||||||::|..:||||..:|||:||||||:|   
Mouse    80 PGVIGGSKPK-VATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR--- 140

  Fly   134 LWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPPA 198
                  |..|                           |.|..||..:..:..:|.|:.:.:   :
Mouse   141 ------TKVQ---------------------------QPPNQPVPASSHSIVSTGSVTQVS---S 169

  Fly   199 LMMNSAGE-----------MPIKPAPKMPPSMG-------HGHS----HGLNPNVSG-------- 233
            :..:|||.           .|.....|.....|       :|||    ..|...:.|        
Mouse   170 VSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL 234

  Fly   234 --LDLSYSALHKHWLWNPSLLYYTQAHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTSALGGF 296
              ||..:...|.      |.::.|...|:.:      |...|:      |||:.|       ||.
Mouse   235 EVLDRVFERQHY------SDIFTTTEPIKPE------QTTEYS------AMASLA-------GGL 274

  Fly   297 TKSESSIDLSTPGAAGDALSDCDSGKSSPA-----------ALSLTASG-------GGNGAGSAP 343
            ...::::...||         .|.|.|.|.           ..|.|..|       .|.|:.|||
Mouse   275 DDMKANLTSPTP---------ADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAP 330

  Fly   344 EAS---PGSTLSHSRKRNPYS 361
            ..:   |||..|.|    |||
Mouse   331 TLTGMVPGSEFSGS----PYS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 93/127 (73%)
Pax5NP_032808.1 PAX 16..140 CDD:128645 92/124 (74%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 19..75 47/55 (85%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 94..142 28/56 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..218 6/35 (17%)
Pax2_C 285..389 CDD:289189 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002430
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.