DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Pax1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006498974.1 Gene:Pax1 / 18503 MGIID:97485 Length:534 Species:Mus musculus


Alignment Length:366 Identity:134/366 - (36%)
Similarity:170/366 - (46%) Gaps:103/366 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGSIG 73
            |||||||||||||||:.:|.|||:||..|:|||||||||.||||||||||.|:.|||||.||:||
Mouse   181 VNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIG 245

  Fly    74 GSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSGLWTDE 138
            |||.: |.||.|||.|...|:.:.|:||||||::|....|||..:|||:|||:|||||.      
Mouse   246 GSKPR-VTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNK------ 303

  Fly   139 MTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPPALMMNS 203
                             ....|..||   |.....|||                   .|||..|.
Mouse   304 -----------------IGSLAQPGP---YEASKQPPP-------------------QPALPYNH 329

  Fly   204 AGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHKHWLWNPS------------LLYYTQ 256
            ..:.|. |:|..|.    |...|.:|.|.| ...:.::.:.|   ||            .:..|.
Mouse   330 IYQYPY-PSPVSPT----GTKMGTHPGVPG-SAGHVSIPRSW---PSAHSVSNILGIRTFMEQTG 385

  Fly   257 AHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTSALGGFTKSESSIDLSTPGAAGDALSDCDSG 321
            |...::.||...:...:||      :..||..::.|:.|..|.....|:                
Mouse   386 ALAGSEGAAYSPKMEDWAG------VNRAAFPTSPAVNGLEKPALEADI---------------- 428

  Fly   322 KSSPAALSLTASGG-----------GNGAGSAPEA---SPG 348
            |.:.:|.||:|.||           .:|..|||.|   |||
Mouse   429 KYTQSASSLSAVGGFLPACAYPASNQHGVYSAPAAGYLSPG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 84/123 (68%)
Pax1XP_006498974.1 PAX 177..304 CDD:238076 84/146 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.