DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and egl-38

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_501836.1 Gene:egl-38 / 177876 WormBaseID:WBGene00001204 Length:289 Species:Caenorhabditis elegans


Alignment Length:259 Identity:111/259 - (42%)
Similarity:146/259 - (56%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSI 67
            ||   |||||||||||||||.|.||.:||:::..|.|||||||||.||||||||||.|:|.|||:
 Worm    30 HT---GVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSV 91

  Fly    68 RPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNS 132
            |||.|||||.| ||||.||:.|...|..|..|||||||::|.:.::|...:|||:||||||:||.
 Worm    92 RPGVIGGSKPK-VATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNK 155

  Fly   133 GLWTDEMTSSQQNAAAAAAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPP 197
            .........:...::||..::|.:.||           ::||..|........:...:.:.....
 Worm   156 SFMAQLAAPTSVTSSAARPSSATSHHQ-----------RSPPRGVQQHMQQSTSVQQLQQLQLTS 209

  Fly   198 ALMMNSAGEMPIKPAPKMPPSMGHGHSHGLN------PNVSGLDLSYSALHKHWLWNPSLLYYT 255
            |..:||   :...||..||     |.::.:|      |..|.||..::.|..... :.||:|.|
 Worm   210 AATVNS---LMTPPAFAMP-----GTAYSINGLLGTLPQPSLLDDKFTNLSTQSA-DMSLVYST 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362 83/127 (65%)
egl-38NP_501836.1 PAX 29..153 CDD:128645 83/126 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002430
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.