powered by:
Protein Alignment Poxn and Cphx1
DIOPT Version :9
Sequence 1: | NP_001261016.1 |
Gene: | Poxn / 36741 |
FlyBaseID: | FBgn0003130 |
Length: | 425 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_780551.1 |
Gene: | Cphx1 / 105594 |
MGIID: | 2145733 |
Length: | 182 |
Species: | Mus musculus |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 16/37 - (43%) |
Gaps: | 5/37 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 DLSTPGAAGDALSDCDS-----GKSSPAALSLTASGG 335
|...|.|:|:..|.||| |:.|...:....:.|
Mouse 109 DTQPPKASGEQYSSCDSVVRSIGRQSIGTVEHQGAAG 145
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Poxn | NP_001261016.1 |
HTH |
5..133 |
CDD:304362 |
|
Cphx1 | NP_780551.1 |
homeodomain |
29..82 |
CDD:238039 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0849 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.