DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxn and Cphx1

DIOPT Version :9

Sequence 1:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:37 Identity:11/37 - (29%)
Similarity:16/37 - (43%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 DLSTPGAAGDALSDCDS-----GKSSPAALSLTASGG 335
            |...|.|:|:..|.|||     |:.|...:....:.|
Mouse   109 DTQPPKASGEQYSSCDSVVRSIGRQSIGTVEHQGAAG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxnNP_001261016.1 HTH 5..133 CDD:304362
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.