DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and DAR5

DIOPT Version :10

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_201464.2 Gene:DAR5 / 836795 AraportID:AT5G66630 Length:702 Species:Arabidopsis thaliana


Alignment Length:143 Identity:36/143 - (25%)
Similarity:51/143 - (35%) Gaps:50/143 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2013 PGVRIPL--CNSCNVQIR-GPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFE 2074
            |.|..||  |..||..:: ...:..||.:|.|..|.|  .:|.:|:                   
plant   338 PEVNPPLSMCGGCNSAVKHEESVNILGVLWHPGCFCC--RSCDKPI------------------- 381

  Fly  2075 KYLAPTCSKCAGKIKGDCLNAIGKHFHPECFT--CGQCG----KIFGNRPFFLEDGNAYC---EA 2130
                     ...:::....|:.|| ||..|:.  |..|.    |.:...||:.|   .||   ||
plant   382 ---------AIHELENHVSNSRGK-FHKSCYERYCYVCKEKKMKTYNIHPFWEE---RYCPVHEA 433

  Fly  2131 DWNELFTTKCFAC 2143
            |.    |.||.:|
plant   434 DG----TPKCCSC 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_ZASP52-like 8..88 CDD:467281
DUF4749 150..>218 CDD:464948
LIM_ALP_like 282..333 CDD:188746
PHA03247 <762..1006 CDD:223021
LIM1_Enigma_like_1 2020..2073 CDD:188839 11/53 (21%)
LIM 2081..2132 CDD:259829 16/59 (27%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 2/4 (50%)
DAR5NP_201464.2 RPW8 7..147 CDD:398988
NB-ARC 179..>305 CDD:395745
LIM_DA1 347..402 CDD:188782 16/85 (19%)
DA1-like 488..700 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.