DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and DAR7

DIOPT Version :10

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001190637.1 Gene:DAR7 / 836793 AraportID:AT5G66610 Length:587 Species:Arabidopsis thaliana


Alignment Length:167 Identity:40/167 - (23%)
Similarity:58/167 - (34%) Gaps:58/167 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2019 LCNSCNVQIR-GPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCS 2082
            :|:.|...|. |..:.|||..|.|:.|.|  ..|.:|:....|...||..:.. |:|:       
plant   200 ICDGCKSAIEYGRSVHALGVNWHPECFCC--RYCDKPIAMHEFSNTKGRCHIT-CYER------- 254

  Fly  2083 KCAGKIKGDCLNAIGKHFHPECFTCGQ--CGKIFGNRPFFLEDGNAYC---EADWNELFTTKCFA 2142
                             .||.|..|.:  .|:.:...||:.|   .||   |.|.    |.||.:
plant   255 -----------------SHPNCHVCKKKFPGRKYKEHPFWKE---KYCPFHEVDG----TPKCCS 295

  Fly  2143 C--------GFPVEAGDRWVEALNHNYHSQCFNCTFC 2171
            |        .:.:.|.:||:          |..|..|
plant   296 CERLEPWGTKYVMLADNRWL----------CVKCMEC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_ZASP52-like 8..88 CDD:467281
DUF4749 150..>218 CDD:464948
LIM_ALP_like 282..333 CDD:188746
PHA03247 <762..1006 CDD:223021
LIM1_Enigma_like_1 2020..2073 CDD:188839 16/53 (30%)
LIM 2081..2132 CDD:259829 11/55 (20%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 8/40 (20%)
DAR7NP_001190637.1 LIM_DA1 201..252 CDD:188782 16/53 (30%)
DA1-like 343..580 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.