DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and DAR4

DIOPT Version :10

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_197291.2 Gene:DAR4 / 831657 AraportID:AT5G17890 Length:1613 Species:Arabidopsis thaliana


Alignment Length:160 Identity:43/160 - (26%)
Similarity:62/160 - (38%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2015 VRIPL--CNSCNVQIR-GPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDL---YCEYCF 2073
            |..||  |..|...|. |..|.|.|.:|.|..|.|:  .||.|:.    :.|..||   |.:.|:
plant  1233 VNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCL--RCREPIA----MNEISDLRGMYHKPCY 1291

  Fly  2074 EKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAYCEADWNELFTT 2138
            ::...|.|..|..||.   ..|.|..:|              ..||::|   .||.:...: .|.
plant  1292 KELRHPNCYVCEKKIP---RTAEGLKYH--------------EHPFWME---TYCPSHDGD-GTP 1335

  Fly  2139 KCFACGFPVEAGDRWVEALNHNYHSQCFNC 2168
            ||.:|......|.::|  :..::...|..|
plant  1336 KCCSCERLEHCGTQYV--MLADFRWLCREC 1363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_ZASP52-like 8..88 CDD:467281
DUF4749 150..>218 CDD:464948
LIM_ALP_like 282..333 CDD:188746
PHA03247 <762..1006 CDD:223021
LIM1_Enigma_like_1 2020..2073 CDD:188839 18/56 (32%)
LIM 2081..2132 CDD:259829 12/50 (24%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 6/29 (21%)
DAR4NP_197291.2 PLN03210 26..>844 CDD:215633
leucine-rich repeat 544..572 CDD:275380
leucine-rich repeat 573..594 CDD:275380
leucine-rich repeat 595..617 CDD:275380
leucine-rich repeat 618..640 CDD:275380
leucine-rich repeat 641..663 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 750..772 CDD:275380
leucine-rich repeat 773..793 CDD:275380
leucine-rich repeat 794..824 CDD:275380
LIM_DA1 1240..1291 CDD:188782 18/56 (32%)
DA1-like 1387..1603 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.