DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and pdlim7

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001025639.1 Gene:pdlim7 / 595027 XenbaseID:XB-GENE-5860425 Length:191 Species:Xenopus tropicalis


Alignment Length:215 Identity:54/215 - (25%)
Similarity:79/215 - (36%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNF 82
            |||||||||.||..||.:.::..|..:|.||:..||.:::|......::.|.:||:.:..|.|..
 Frog    13 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKL 77

  Fly    83 VITVQRGGSTWRPHVTPTGNVPQPNSPYLQTVTKTSLAHKQQDSQHIGCGYNNAARPFSNG---G 144
            .:.:.|    :...|.....|..|.|...:.....|.|            .|..||||..|   .
 Frog    78 GLVLSR----FAVGVNQAKGVHTPESQGRKYNFAPSTA------------LNKIARPFGTGTPPP 126

  Fly   145 DGGVKSIVNK--QYNTPVGIYSDESIAETLSAQAEVLAGGVLGVNFKKNEKEYQGDRSEVLKFLR 207
            |......:.|  .||.|...|:....|                          ||......||:.
 Frog   127 DNSRPGQLTKPVAYNPPPTSYTTSQTA--------------------------QGQLQNGEKFIT 165

  Fly   208 EEETGQSTPAFGNSHYEHDA 227
            |.::.:.| ...:.|:|..|
 Frog   166 ELQSPRYT-RLRDWHHERSA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492 25/68 (37%)
DUF4749 150..>217 CDD:292558 12/68 (18%)
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
pdlim7NP_001025639.1 PDZ_signaling 3..81 CDD:238492 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8692
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013114at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm48439
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.