DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and CG34367

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:391 Identity:79/391 - (20%)
Similarity:136/391 - (34%) Gaps:80/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1264 QQVPQQVTQQ------QQQEHSLLSQTTLAETQTLQANAQSQSSASYSSKATACSNSSSTVPPAN 1322
            :|:.|.||:.      ....|:|.:..|.|..:                |.|...| |..:...:
  Fly     2 EQLAQFVTKSFEFNLTNNSVHALFNSMTGARLK----------------KPTEVKN-SIFINSIS 49

  Fly  1323 TSTAFAPAPAPAPTSIPVRPSAIAVQSSYCSSQFDVHELIEETAEELEHSEVLFPPPSPLSHLTK 1387
            :..::|...|....|:.:..:.::|..|......|.....|..::..||.|.....|:       
  Fly    50 SGGSYADTCASGEESVDIDITDLSVSESNTILAIDPEPTEESHSQREEHVETYSLSPT------- 107

  Fly  1388 QGKAVQSGLHKADSIPKYQRNWTVLPTQSPIRTPEPQELRENVPLAFVDAPKAPVTSDSSTVHRP 1452
                    ||||...|| .:||.:.........||..:: ..:|.|.:    ...|.||:|....
  Fly   108 --------LHKAAVEPK-PKNWLISEDLDVDSQPEDPKM-SGLPTASI----TECTEDSNTPKLA 158

  Fly  1453 IAQVAAPTTVVAPSREREKERRPQLSVPII-VEDRSGPVTMAFQPLDELVR-------PDQALTP 1509
            ..:...|...|:|...|.:|....|...:: .:.|..........|:||.|       ||..:..
  Fly   159 PDKPLLPEECVSPEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMRE 223

  Fly  1510 TRPYTPSLTNKPAPIVPFYQTEEKLVFEECSATHARNYNELNASPFPDRTRSPAPGPPPNPLNAI 1574
            .......|:          :...::.|:...|...::.|:::.. |...:|||   |...||...
  Fly   224 ELSQRLGLS----------EARVQVWFQNRRAKCRKHENQMHKG-FLVGSRSP---PIATPLEPC 274

  Fly  1575 R-APRMKEPETKSNILSVSGGPRLQTGSI-----TTGQSYQGQLLA------HSEQSSQSASQSY 1627
            | ||.:.....:|:  ||...|...|.|.     .:|.|..|:::.      |:...|:||.:.:
  Fly   275 RVAPYVSLAALRSS--SVPSHPAAATSSNPQAPGVSGTSSSGKVVTVDSPHNHNPAISRSAIKQF 337

  Fly  1628 N 1628
            :
  Fly   338 S 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 9/62 (15%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.