DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and gsc

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001016704.1 Gene:gsc / 549458 XenbaseID:XB-GENE-486771 Length:243 Species:Xenopus tropicalis


Alignment Length:219 Identity:44/219 - (20%)
Similarity:71/219 - (32%) Gaps:68/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1577 PRMKE----PETKSNILSVSG----GPRLQTG------------SITTGQS------YQGQLLAH 1615
            ||.||    |:....:.|..|    ||...:|            ...||..      |.|||...
 Frog    16 PRCKESVLLPQNGPMVFSSLGESLYGPADYSGFYNRAVAPTSTLQAVTGSRLGFNNYYYGQLHVQ 80

  Fly  1616 SEQ--SSQSASQSYNQQP-----------------------ERITEQRVGNLNIQQREQSSQLQQ 1655
            :..  |...|.||...|.                       :.:....||.|:    ....||..
 Frog    81 TPMGPSCCGAVQSLGTQQCSCVPPATAYDGAGSVLMPPVPHQMLPYMNVGTLS----RTELQLLN 141

  Fly  1656 QAQSQTQSQTRSQVGNTQIERRRKVTEEFE------RTQSAKTIEIRTGSQSV----SQSKAQSQ 1710
            |...:.:.:.|:...:.|:|....:.:|.:      |.|.|:.:.:|.....|    .::|.:.|
 Frog   142 QLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKVEVWFKNRRAKWRRQ 206

  Fly  1711 SISQAQTQAQSQSQNQS---DTER 1731
            ..|.::....:|..|:|   .||:
 Frog   207 KRSSSEESENTQKWNKSSKNSTEK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
gscNP_001016704.1 Homeobox 151..204 CDD:278475 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.