Sequence 1: | NP_001027420.2 | Gene: | Zasp52 / 36740 | FlyBaseID: | FBgn0265991 | Length: | 2194 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004015.1 | Gene: | lhx6a / 445565 | ZFINID: | ZDB-GENE-041025-1 | Length: | 375 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 42/200 - (21%) |
---|---|---|---|
Similarity: | 65/200 - (32%) | Gaps: | 77/200 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 1996 ATSAPKRGRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGR-IWCPDHFICVNGNCRRPLQDIG 2059
Fly 2060 FVEEKGDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDG 2124
Fly 2125 NAYCEADWNELFTTKCFACGFPVEAGDRWVEALNHN-YHSQCFNCTFCKQNLE-GQSFYNKGGRP 2187
Fly 2188 FCKNH 2192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp52 | NP_001027420.2 | PDZ_signaling | 6..87 | CDD:238492 | |
DUF4749 | 150..>217 | CDD:292558 | |||
LIM_ALP_like | 282..333 | CDD:188746 | |||
LIM1_Enigma_like_1 | 2020..2073 | CDD:188839 | 8/53 (15%) | ||
LIM | 2081..2132 | CDD:259829 | 6/50 (12%) | ||
LIM3_Enigma_like_1 | 2140..2193 | CDD:188845 | 19/54 (35%) | ||
lhx6a | NP_001004015.1 | LIM1_Lhx6 | 97..150 | CDD:188766 | 14/112 (13%) |
LIM2_Lhx6 | 158..212 | CDD:188768 | 19/54 (35%) | ||
Homeobox | 250..302 | CDD:278475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |