DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and lhx6a

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001004015.1 Gene:lhx6a / 445565 ZFINID:ZDB-GENE-041025-1 Length:375 Species:Danio rerio


Alignment Length:200 Identity:42/200 - (21%)
Similarity:65/200 - (32%) Gaps:77/200 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1996 ATSAPKRGRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGR-IWCPDHFICVNGNCRRPLQDIG 2059
            |:|.|..|:.:             |.||.::|...::..:.. ||   |..|:.           
Zfish    86 ASSVPSTGKNV-------------CASCGLEILDRYLLKVNNLIW---HVRCLE----------- 123

  Fly  2060 FVEEKGDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDG 2124
                                 ||.|...::.          |..|               ::::.
Zfish   124 ---------------------CSVCRTSLRQ----------HSSC---------------YIKNK 142

  Fly  2125 NAYCEADWNELFTTKCFACGFPVEAGDRWVEALNHN-YHSQCFNCTFCKQNLE-GQSFYNKGGRP 2187
            ..:|:.|:...|.|||..||..:.|.| ||.....| ||..||.|..||:.|. |:.|.....:.
Zfish   143 EIFCKMDYFSRFGTKCARCGRQIYASD-WVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKV 206

  Fly  2188 FCKNH 2192
            .|:.|
Zfish   207 LCRIH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 8/53 (15%)
LIM 2081..2132 CDD:259829 6/50 (12%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 19/54 (35%)
lhx6aNP_001004015.1 LIM1_Lhx6 97..150 CDD:188766 14/112 (13%)
LIM2_Lhx6 158..212 CDD:188768 19/54 (35%)
Homeobox 250..302 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.