DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Zasp66

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:335 Identity:65/335 - (19%)
Similarity:108/335 - (32%) Gaps:135/335 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRG-------GSTWR--------------- 94
            ||.:.||.:.|..:|.|.|||.:...:||...:.|.|.       |:|..               
  Fly    81 GDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVT 145

  Fly    95 ----PHVTPTGNVPQP------------------------------------------------- 106
                ||..|:..:|.|                                                 
  Fly   146 PDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDE 210

  Fly   107 ------NSPYLQT--------------VTKTSLAHKQQDS--QHIGCGYNNA------ARPFSN- 142
                  |.||..|              .|::.|.|....:  .|.|..|:::      |....: 
  Fly   211 EQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHK 275

  Fly   143 --GGDGGVKSIVNKQYNTPVGIYSDESIAETL-------SAQAEVLAGGVL------GVNFKKNE 192
              |.:.....:.:||:|:|:|:||:.:|.:|:       ::::..|....|      .:|..|..
  Fly   276 VVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKT 340

  Fly   193 KEYQGDRSEVLKFLREEETGQSTPAFGNSHYEHDAPQQLQQPQQQYNQHQQHYHQQQQQQQSSTT 257
            .:|....||..:.::||.        |.|:|...:||::..|.|.        ...|..:.....
  Fly   341 VQYDPRNSETYRAIQEEG--------GYSNYGQSSPQEVTIPVQT--------KVYQPNRLVPGK 389

  Fly   258 RHVSAPVNSP 267
            :.|||||:.|
  Fly   390 KPVSAPVSRP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492 12/34 (35%)
DUF4749 150..>217 CDD:292558 18/79 (23%)
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/33 (36%)
DUF4749 285..359 CDD:292558 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.