DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Zasp66

DIOPT Version :10

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:335 Identity:65/335 - (19%)
Similarity:108/335 - (32%) Gaps:135/335 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRG-------GSTWR--------------- 94
            ||.:.||.:.|..:|.|.|||.:...:||...:.|.|.       |:|..               
  Fly    81 GDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVT 145

  Fly    95 ----PHVTPTGNVPQP------------------------------------------------- 106
                ||..|:..:|.|                                                 
  Fly   146 PDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDE 210

  Fly   107 ------NSPYLQT--------------VTKTSLAHKQQDS--QHIGCGYNNA------ARPFSN- 142
                  |.||..|              .|::.|.|....:  .|.|..|:::      |....: 
  Fly   211 EQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHK 275

  Fly   143 --GGDGGVKSIVNKQYNTPVGIYSDESIAETL-------SAQAEVLAGGVL------GVNFKKNE 192
              |.:.....:.:||:|:|:|:||:.:|.:|:       ::::..|....|      .:|..|..
  Fly   276 VVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKT 340

  Fly   193 KEYQGDRSEVLKFLREEETGQSTPAFGNSHYEHDAPQQLQQPQQQYNQHQQHYHQQQQQQQSSTT 257
            .:|....||..:.::||.        |.|:|...:||::..|.|.        ...|..:.....
  Fly   341 VQYDPRNSETYRAIQEEG--------GYSNYGQSSPQEVTIPVQT--------KVYQPNRLVPGK 389

  Fly   258 RHVSAPVNSP 267
            :.|||||:.|
  Fly   390 KPVSAPVSRP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_ZASP52-like 8..88 CDD:467281 13/35 (37%)
DUF4749 150..>218 CDD:464948 18/80 (23%)
LIM_ALP_like 282..333 CDD:188746
PHA03247 <762..1006 CDD:223021
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Zasp66NP_729395.2 PDZ_canonical <68..117 CDD:483948 13/35 (37%)
DUF4749 285..374 CDD:464948 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.