Sequence 1: | NP_001027420.2 | Gene: | Zasp52 / 36740 | FlyBaseID: | FBgn0265991 | Length: | 2194 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729395.2 | Gene: | Zasp66 / 38988 | FlyBaseID: | FBgn0035917 | Length: | 430 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 65/335 - (19%) |
---|---|---|---|
Similarity: | 108/335 - (32%) | Gaps: | 135/335 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 GDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRG-------GSTWR--------------- 94
Fly 95 ----PHVTPTGNVPQP------------------------------------------------- 106
Fly 107 ------NSPYLQT--------------VTKTSLAHKQQDS--QHIGCGYNNA------ARPFSN- 142
Fly 143 --GGDGGVKSIVNKQYNTPVGIYSDESIAETL-------SAQAEVLAGGVL------GVNFKKNE 192
Fly 193 KEYQGDRSEVLKFLREEETGQSTPAFGNSHYEHDAPQQLQQPQQQYNQHQQHYHQQQQQQQSSTT 257
Fly 258 RHVSAPVNSP 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp52 | NP_001027420.2 | PDZ_signaling | 6..87 | CDD:238492 | 12/34 (35%) |
DUF4749 | 150..>217 | CDD:292558 | 18/79 (23%) | ||
LIM_ALP_like | 282..333 | CDD:188746 | |||
LIM1_Enigma_like_1 | 2020..2073 | CDD:188839 | |||
LIM | 2081..2132 | CDD:259829 | |||
LIM3_Enigma_like_1 | 2140..2193 | CDD:188845 | |||
Zasp66 | NP_729395.2 | PDZ_signaling | <68..115 | CDD:238492 | 12/33 (36%) |
DUF4749 | 285..359 | CDD:292558 | 18/81 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24214 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.130 |