DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Awh

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:145 Identity:38/145 - (26%)
Similarity:53/145 - (36%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2051 CRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQC-GKIF 2114
            |..|:.|..|:|..|               ||                 :|..|..|..| ..:.
  Fly    11 CGEPISDRFFLEVGG---------------CS-----------------WHAHCLRCCMCMCPLD 43

  Fly  2115 GNRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWV-EALNHNYHSQCFNCTFCKQNLE-G 2177
            ..:..|:.:...||:||:::.|..||..|...:.|.| || .|....:|..||.|..|.:.|. |
  Fly    44 RQQSCFIRERQVYCKADY
SKNFGAKCSKCCRGISASD-WVRRARELVFHLACFACDQCGRQLSTG 107

  Fly  2178 QSFYNKGGRPFCKNH 2192
            :.|.....|..||.|
  Fly   108 EQFALMDDRVLCKAH 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 6/21 (29%)
LIM 2081..2132 CDD:259829 10/51 (20%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 19/55 (35%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 16/81 (20%)
LIM2_AWH 69..123 CDD:188765 19/55 (35%)
Homeobox 152..204 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.