DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and LHX6

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:297 Identity:62/297 - (20%)
Similarity:94/297 - (31%) Gaps:124/297 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1913 PSIASITA-PGSASAPAPVPSAAPTK---ATAPFKAPIVPKS---VIANAV-------NAAAPPA 1963
            |:...:.| |||.       ..|.|:   .|||   |.:.:|   .:|.|:       :...|..
Human    24 PATDQVMAQPGSG-------CKATTRCLEGTAP---PAMAQSDAEALAGALDKDEGQASPCTPST 78

  Fly  1964 PAVFPPDLSDLNLNSNVDNSPGAGGKSAGAFGATSAPKRGRGILNKAAGPGVRIPLCNSCNVQIR 2028
            |:|..|              |.|         |:|.|..|:.|             |:||.::|.
Human    79 PSVCSP--------------PSA---------ASSVPSAGKNI-------------CSSCGLEIL 107

  Fly  2029 GPFITALGR-IWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSKCAGKIKGDC 2092
            ..::..:.. ||   |..|:.                                ||.|...::.. 
Human   108 DRYLLKVNNLIW---HVRCLE--------------------------------CSVCRTSLRQQ- 136

  Fly  2093 LNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWVEAL 2157
                           ..|         ::::...:|:.|:...|.|||..||..:.|.| ||...
Human   137 ---------------NSC---------YIKNKEIFCKMDYFSRFGTKCARCGRQIYASD-WVRRA 176

  Fly  2158 NHN-YHSQCFNCTFCKQNLE-GQSFYNKGGRPFCKNH 2192
            ..| ||..||.|..||:.|. |:.|.....:..|:.|
Human   177 RGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 8/53 (15%)
LIM 2081..2132 CDD:259829 5/50 (10%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 20/55 (36%)
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 13/112 (12%)
LIM2_Lhx6 160..214 CDD:188768 20/55 (36%)
Homeobox 252..304 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.