DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and rga1

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_596743.1 Gene:rga1 / 2541022 PomBaseID:SPBC3F6.05 Length:1150 Species:Schizosaccharomyces pombe


Alignment Length:266 Identity:66/266 - (24%)
Similarity:104/266 - (39%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1961 PPAPAVFPPDLSDLNLNSNVDNSPGAGGKS--AGAFGATSAPKR-----------------GRGI 2006
            ||.....|...:.:..||...|.|.:...|  ||..|.:|..:|                 ..|:
pombe    22 PPKRIPVPSRQNKIEENSTTKNFPHSRHTSTVAGTEGGSSLSRRHTSAESRKALPNQQQLAQSGL 86

  Fly  2007 LNKAAGPGVR------IP----------LCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRR-- 2053
            |||.....::      .|          :|.||...|.|.::.|||.|:..:.|.|  .:|..  
pombe    87 LNKEEQQSLKRSDTSVFPKAVRKVSSSKICASCGQVISGQYVRALGNIYHLECFRC--HDCNSLV 149

  Fly  2054 -----PLQDIGFVEEKGDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKI 2113
                 |:.|...  .|....||..:.:.|...|:.|...::|..:.|:.|.||.|.|||..|..:
pombe   150 ASKFFPIDDPTL--NKQVPLCETDYFRRLDLLCASCGMALRGYYITALNKKFHIEHFTCSLCYTV 212

  Fly  2114 FG-NRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWVE----ALNHNYHSQC------FN 2167
            || |..::..:|..||...::.||..:|..|..|:..  ::||    .::.|:|..|      :|
pombe   213 FGPNDSYYEYEGKVYCHYHYSTLFAARCCGCDGPILR--QFVEVYRNGVSQNWHVPCHMIYKFWN 275

  Fly  2168 CTFCKQ 2173
            ...|::
pombe   276 VKLCQK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 17/59 (29%)
LIM 2081..2132 CDD:259829 18/51 (35%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 10/44 (23%)
rga1NP_596743.1 LIM1_Lrg1p_like 116..172 CDD:188777 17/59 (29%)
LIM2_Lrg1p_like 180..232 CDD:188778 18/51 (35%)
LIM 485..539 CDD:295319
RhoGAP_fLRG1 835..1044 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.