DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Pitx3

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:421 Identity:94/421 - (22%)
Similarity:132/421 - (31%) Gaps:160/421 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1562 PAPGPP----PNPLNAIRAPRMK-----EPETKSNILSVSGG-----PRLQTGSITTGQSYQGQL 1612
            |.||||    .:.:...|.|.|:     |.|.:|..||:|..     |..:.|.       :|| 
Mouse    66 PLPGPPSTEIEDEIKRQRPPSMEFGLLGEAEARSPALSLSDAGTPHPPLPEHGC-------KGQ- 122

  Fly  1613 LAHSEQSSQSASQSYNQQPERITEQRVGNLNIQQREQ-----SSQLQQ-----QAQSQTQSQTRS 1667
             .||:....|||.. ...||.      |:|..:||.|     |.|||:     |........||.
Mouse   123 -EHSDSEKASASLP-GGSPED------GSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTRE 179

  Fly  1668 QVG----------NTQIERRRKVTEEFERTQSAKTIEIRTGSQSVSQSKAQSQSISQAQTQAQSQ 1722
            ::.          ....:.||....:.||:|.|:..                             
Mouse   180 EIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELC----------------------------- 215

  Fly  1723 SQNQSDTERRSSYGKTGFVASQAKRLSCMEEEISSLTSQSQAISARASALGEGCFPNLRSPTFDS 1787
                          |.||.|.....:...||.....:..:....|.|        |.|.:.||..
Mouse   216 --------------KGGFAAPLGGLVPPYEEVYPGYSYGNWPPKALA--------PPLAAKTFPF 258

  Fly  1788 KF------PLKPAP--------AESIVPGYATVPAATKMLTAPPPGFLQQQQQQQQRSAFSGYQA 1838
            .|      ||...|        |.|:||..|..|.     |.|.||.||            |...
Mouse   259 AFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPG-----TVPGPGALQ------------GLGG 306

  Fly  1839 TTSSVQQSSFASSSKATTSSLSSSSASASASASVARSSQSLTQASAITTTTNNQATTAYRS-SNG 1902
            ....:..::.:|      .::|...|||:|:|:.|.||..:                 ||. .|.
Mouse   307 APPGLAPAAVSS------GAVSCPYASAAAAAAAAASSPYV-----------------YRDPCNS 348

  Fly  1903 SITKPNLASRPSIASITAPGSASAPAPVPSA 1933
            |:....|.::.. ||.:.|   :.|.|.|:|
Mouse   349 SLASLRLKAKQH-ASFSYP---AVPGPPPAA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 9/52 (17%)
PTZ00395 <228..>322 CDD:185594 26/124 (21%)
OAR 344..361 CDD:367680 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.