DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and lim-4

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_508669.1 Gene:lim-4 / 180672 WormBaseID:WBGene00002987 Length:355 Species:Caenorhabditis elegans


Alignment Length:306 Identity:67/306 - (21%)
Similarity:102/306 - (33%) Gaps:99/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1892 QATTAYRSSNGSITKPNLASRPSIASITAPGSASAPAPVPSAAPTKATAPFKAPIVPKSVIANAV 1956
            :.:||...|:.|:|.|.:....|..|:|.....|..:.:....|..|...|.:.......|::|:
 Worm    10 KTSTASELSDSSLTFPFIGDYLSSPSLTTSDYVSDCSNLTVEGPVPANQEFSSSDESSVYISSAL 74

  Fly  1957 NAAAPPAPAVFPPDLSDLNLNSNVDNSPGAGGKSAGAFGATSAPKRGRGILNKAAGPGVRIPLCN 2021
            ..    |...|.||       .|:...|.|                             .|.:|.
 Worm    75 RL----ADYAFTPD-------DNIRIKPDA-----------------------------VIVICT 99

  Fly  2022 SCNVQIRGPFITAL-GRIWCPDHFICVN-GNCRRPLQDIGFVEEKGDLYCEYC-FEKYLAPTCSK 2083
            .|..||:..|..:: ||.:   |..|:. ..|..||.:..|.::| ..||:.| |..::..|.|.
 Worm   100 QCQHQIQDKFFLSIDGRNY---HENCLQCSTCENPLSNKCFYKDK-TFYCKGCYFRTHVTSTASS 160

  Fly  2084 CAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAYCEADWNELFTTKCFACGFPVE 2148
            |             :...|                                    ||.:|...::
 Worm   161 C-------------RELGP------------------------------------KCASCDRTIQ 176

  Fly  2149 AGDRWV-EALNHNYHSQCFNCTFCKQNLE-GQSFYNKGGRPFCKNH 2192
            |.| || .|.|:.||..||:|..||:.|. |:.:..:.|...||.|
 Worm   177 ATD-WVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 17/55 (31%)
LIM 2081..2132 CDD:259829 3/50 (6%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 21/55 (38%)
lim-4NP_508669.1 LIM 98..153 CDD:278823 18/58 (31%)
LIM2_AWH 168..222 CDD:188765 21/55 (38%)
HOX 239..295 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.