| Sequence 1: | NP_001027420.2 | Gene: | Zasp52 / 36740 | FlyBaseID: | FBgn0265991 | Length: | 2194 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001255672.1 | Gene: | pin-2 / 178234 | WormBaseID: | WBGene00004030 | Length: | 330 | Species: | Caenorhabditis elegans |
| Alignment Length: | 249 | Identity: | 49/249 - (19%) |
|---|---|---|---|
| Similarity: | 84/249 - (33%) | Gaps: | 66/249 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2007 LNKAAGPGVRIPLCNSCNVQ--IRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYC 2069
Fly 2070 EYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAYC------ 2128
Fly 2129 --------------EADWNELFT----------TKCFACGFPVEAGDRWVE-------------- 2155
Fly 2156 ------------------ALNHNYHSQCFNCTFCKQNLEGQSFYNKGGRPFCKN 2191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Zasp52 | NP_001027420.2 | PDZ_signaling | 6..87 | CDD:238492 | |
| DUF4749 | 150..>217 | CDD:292558 | |||
| LIM_ALP_like | 282..333 | CDD:188746 | |||
| LIM1_Enigma_like_1 | 2020..2073 | CDD:188839 | 13/54 (24%) | ||
| LIM | 2081..2132 | CDD:259829 | 12/70 (17%) | ||
| LIM3_Enigma_like_1 | 2140..2193 | CDD:188845 | 14/84 (17%) | ||
| pin-2 | NP_001255672.1 | LIM1_PINCH | 21..79 | CDD:188717 | 14/59 (24%) |
| LIM | 82..133 | CDD:295319 | 12/50 (24%) | ||
| LIM | 144..195 | CDD:295319 | 8/50 (16%) | ||
| LIM4_PINCH | 200..256 | CDD:188720 | 10/55 (18%) | ||
| LIM | 264..315 | CDD:295319 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||