DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Y1A5A.1

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_497801.1 Gene:Y1A5A.1 / 175515 WormBaseID:WBGene00012379 Length:192 Species:Caenorhabditis elegans


Alignment Length:115 Identity:40/115 - (34%)
Similarity:57/115 - (49%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  2019 LCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSK 2083
            ||..|:..|....:.|:.|:|.||||.|  .:|:||::.. |.......||..||.:...|.|:.
 Worm    66 LCGHCHQSIGSEALVAMNRLWHPDHFTC--SSCKRPIKQT-FQAADNHAYCVQCFAQKYNPKCAG 127

  Fly  2084 CAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAY-CEADW 2132
            |...:...||.|:.:|:||.||||..|.:...|..|:|.|...| .:..|
 Worm   128 CMETLVDTCLLALDRHWHPRCFTCSSCNRPLPNGEFYLVDDKPYDLDCHW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 17/52 (33%)
LIM 2081..2132 CDD:259829 18/51 (35%)
LIM3_Enigma_like_1 2140..2193 CDD:188845
Y1A5A.1NP_497801.1 LIM 67..117 CDD:295319 17/52 (33%)
LIM_DA1 125..176 CDD:188782 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.