DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp52 and Pdlim3

DIOPT Version :9

Sequence 1:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster
Sequence 2:NP_446102.2 Gene:Pdlim3 / 114108 RGDID:620427 Length:364 Species:Rattus norvegicus


Alignment Length:393 Identity:113/393 - (28%)
Similarity:164/393 - (41%) Gaps:97/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNF 82
            ||||||.||.||.|||::.::..||.:|.|.|.|||.::.|:.....::.|.||||.:..:....
  Rat    12 PWGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQL 76

  Fly    83 VITVQRGGS-TWRPHVTPTGNVPQPNSPYLQTVTKTSLAHKQQDSQHIGCGYNNAARPF-----S 141
            .:.:.|..: .|.|.|:..|..    .|:     |.:|..:.||..:....:|...:||     :
  Rat    77 CLKIDRAETRLWSPQVSEDGKA----HPF-----KINLEAEPQDVNYFEHKHNIRPKPFIIPGRT 132

  Fly   142 NG---------GDG-----------------------------------GVKSIVNKQYNTPVGI 162
            :|         |.|                                   ||| ||:.|:|||:.:
  Rat   133 SGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLEMELPGVK-IVHAQFNTPMQL 196

  Fly   163 YSDESIAETLSAQAEVLAGGVLGVNFKKNEKEYQGDRSEVLKFLREEETGQSTPAFGNSHYEHDA 227
            |||::|.|||..|.....|....::........|.|...:|...|:|      ||         |
  Rat   197 YSDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNRDE------PA---------A 246

  Fly   228 PQQ---LQQPQQQYNQHQQHYHQQQQQQQSSTTRHVSAPVNSPKPPSTGGLPTGQN--ICTECER 287
            |:|   .:..|:..|        .....:.:.||.|.|||....    ||....|.  :|.:|..
  Rat   247 PRQSGSFRVLQELVN--------DGSDDRPAGTRSVRAPVTKVH----GGAGGAQRMPLCDKCGS 299

  Fly   288 LITGVFVRIKDKNLHVECFKCATCGTSLKNQGYYNFNNKLYCDIHAKQAAINNPPTGTEGYVPVP 352
            .|.|..|:.:||..|.|||.||.|..:||.:||:....:|||::||:  |...||   |||..|.
  Rat   300 GIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCEMHAR--ARTRPP---EGYDTVT 359

  Fly   353 IKP 355
            :.|
  Rat   360 LYP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492 27/68 (40%)
DUF4749 150..>217 CDD:292558 20/66 (30%)
LIM_ALP_like 282..333 CDD:188746 21/50 (42%)
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Pdlim3NP_446102.2 PDZ_signaling 2..80 CDD:238492 27/67 (40%)
DUF4749 184..263 CDD:406377 28/102 (27%)
LIM_ALP 294..346 CDD:188834 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10028
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.