DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and VMA7

DIOPT Version :9

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_011534.1 Gene:VMA7 / 852903 SGDID:S000003252 Length:118 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:59/115 - (51%)
Similarity:76/115 - (66%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AIKGKLISVIGDEDTCVGFLLGGVGEIN-KNRHPNFMVVDK-NTAVSELEDCFKRFL-KRDDIDI 67
            |.|..||:||.||||..|.||.|:|:|. :.:..||.|..: .|...|:.|.|..|. :||||.|
Yeast     2 AEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEERDDIAI 66

  Fly    68 ILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMF 117
            :||||:.||.||..:|:.|:..||:|||||||||||..|||:|:|.|.:|
Yeast    67 LLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLF 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 59/115 (51%)
VMA7NP_011534.1 V_ATP_synt_F 1..118 CDD:130171 59/115 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344250
Domainoid 1 1.000 99 1.000 Domainoid score I1597
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3119
Inparanoid 1 1.050 105 1.000 Inparanoid score I1417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54139
OrthoFinder 1 1.000 - - FOG0005005
OrthoInspector 1 1.000 - - oto99778
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - LDO PTHR13861
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1633
SonicParanoid 1 1.000 - - X3539
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.