DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha14-1 and AT4G02620

DIOPT Version :9

Sequence 1:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_192171.1 Gene:AT4G02620 / 828221 AraportID:AT4G02620 Length:128 Species:Arabidopsis thaliana


Alignment Length:112 Identity:58/112 - (51%)
Similarity:82/112 - (73%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQNCA 75
            ||::|.||||.||||:.|||.::..|..|:::||..|.|.::||.||.|..||||.|||::|..|
plant    14 LIAMIADEDTVVGFLMAGVGNVDIRRKTNYLIVDSKTTVRQIEDAFKEFSARDDIAIILLSQYIA 78

  Fly    76 ELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPEDL 122
            .:||.::|::..||||:|||||||||||.:.||:|.|.:.:|:.|.:
plant    79 NMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLFSAESV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 57/107 (53%)
AT4G02620NP_192171.1 ATP-synt_F 9..122 CDD:412487 57/107 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1853
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3119
Inparanoid 1 1.050 128 1.000 Inparanoid score I1898
OMA 1 1.010 - - QHG54139
OrthoDB 1 1.010 - - D1483558at2759
OrthoFinder 1 1.000 - - FOG0005005
OrthoInspector 1 1.000 - - oto3611
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - LDO PTHR13861
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.